Perbedaan Sistem kekebalan dan Sistem limfatik

Keduanya sistem limfatik dan kekebalan tubuh adalah sistem yang terkait erat dalam tubuh kita dan kadang-kadang disebut sebagai sistem limfatik-imunitas.

Fungsi sistem kekebalan tubuh melalui sel-sel dari sistem limfatik dan produk dari sistem kekebalan tubuh biasanya dibawa dalam pembuluh limfatik.

Sistem limfatik

Sistem limfatik adalah kumpulan pembuluh, struktur dan organ yang mengumpulkan protein dan cairan dan mengembalikannya ke sirkulasi utama, dengan demikian mempertahankan keseimbangan cairan tubuh. Hal ini juga sebagai perangkap partikel asing dan menyediakan sel-sel kekebalan untuk pertahanan.

Sistem ini terutama terdiri dari pembuluh getah bening dan kelenjar getah bening, disalurkan melalui tubuh sebagai jaringan.

Fungsi utama dari pembuluh getah bening yang membawa getah bening dari jaringan perifer ke vena dari sistem kardiovaskular, dan kelenjar getah bening adalah untuk memantau konsumsi getah bening, bertindak sebagai situs yang menelan patogen, dan melaksanakan respon imun. Selain kedua komponen tersebut, limpa dan timus juga terkait dengan sistem limfatik.

Cairan dikeringkan oleh sistem ini dikenal sebagai getah bening, yang merupakan cairan bening yang mengandung protein plasma darah kecuali protein yang lebih besar. Sistem limfatik mengembalikan darah melalui dua pembuluh utama, yaitu; saluran toraks dan kanan saluran limfatik.

Sistem imunitas

Sistem kekebalan tubuh memberikan kekebalan jangka panjang terhadap penyakit tertentu dan membela terhadap invasi bakteri dan virus. Sel-sel dan agen lain dari sistem ini terletak di sistem limfatik termasuk, kelenjar getah bening, limpa, tonsil, dan getah bening- terkait organ lain.

Sistem kekebalan tubuh terdiri dari serangkaian sel yang kompleks, faktor kimia, dan organ. Sel-sel induk dari sumsum tulang berkembang menjadi sel-sel sistem kekebalan tubuh selama tahap janin perkembangan manusia. Ada dua jenis khusus dari sel yang bertanggung jawab untuk kegiatan kekebalan tubuh, yaitu B-limfosit dan limfosit T.

Karena, sistem kekebalan tubuh tidak memiliki organ, diketahui populasi sel B dan T yang tinggal di membran mukosa, organ limfatik, dan daerah lain di dalam tubuh. Ada dua jenis kekebalan yang dilakukan oleh sistem kekebalan tubuh; imunitas humoral dan imunitas seluler. Imunitas humoral dilakukan oleh limfosit B dan antibodi, sedangkan imunitas diperantarai sel dilakukan oleh sitotoksik T-limfosit.

Apa perbedaan antara Sistem kekebalan dan Sistem limfatik?

  • Fungsi utamadarisistemlimfatikadalahpenyerapanpemulihan, kekebalan, danlipidcairan, sedangkandari sistem kekebalan tubuhadalahuntuk memberikan kekebalanjangka panjangdan membela terhadapzat-zat asingdengan mengaktifkanrespon imun.
  • Berbeda dengan sistemlimfatik, sistem kekebalan tubuhtidak memilikianatomitertentu.
  • Sistem limfatik adalah suatu sistem organ, seperti sistem kekebalan tubuh.
  • Sistem limfatik terdiri dari kelenjar getah bening, pembuluh getah bening, dan organ terkait lainnya sementara sistem kekebalan tubuh dasarnya terdiri dari limfosit B dan T.
  • Sistem kekebalan tubuhterutamaterkait dengan sistemsarafdanendokrin, sedangkan sistem limfatikdikaitkan dengansistem kardiovaskular.
  • Produk-produk darisistem kekebalan tubuhdiangkutdalam sistemlimfatik.

Join The Discussion